PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0013ss01250.1
Common NameLR48_Vigan08g122700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 257aa    MW: 28347.9 Da    PI: 5.349
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0013ss01250.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-181461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd++l+++++ +G+g+W++ ++  g+ R++k+c++rw +yl
  Vang0013ss01250.1 14 KGPWTPEEDLKLIKYIQTHGPGNWRSLPKSAGLQRCGKSCRLRWTNYL 61
                       79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.362965IPR017930Myb domain
SMARTSM007171.4E-141363IPR001005SANT/Myb domain
PfamPF002492.1E-171461IPR001005SANT/Myb domain
SuperFamilySSF466891.6E-231589IPR009057Homeodomain-like
CDDcd001673.34E-131661No hitNo description
Gene3DG3DSA:1.10.10.605.7E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDLKLIKYIQ THGPGNWRSL PKSAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SLEEEDTIIQ LHSIMGNKTV LNPSLNMQGF LGGAQVLINQ GLLNLAATAS  120
LLENQNLASH NYVQNQVAQP LDITQLQSLE GFSGTVENFS CSNSPSGDEN LVLQQNQVDL  180
LGNHVFAHSM KNAELKKGYD SAMPTPESSP NQLNSSSNYL RSGREEEKNS FCSDLFEFDI  240
PEGLDIADIF CTVPEC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-16128825100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523933.11e-175PREDICTED: transcription factor MYB39
TrEMBLA0A0L9V5R20.0A0A0L9V5R2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SBP00.0A0A0S3SBP0_PHAAN; Uncharacterized protein
STRINGGLYMA06G45460.16e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.14e-55myb domain protein 41
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]